PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004491050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 199aa    MW: 22150.2 Da    PI: 8.1133
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004491050.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.12.2e-41391381100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA++r+rdPvyG++g i++lqqq+++l +el+
  XP_004491050.1  39 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKIFGASNVSKMLMEVSENQRADAANSLVYEANVRLRDPVYGCMGAISSLQQQVQSLLSELN 133
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     +++ee
  XP_004491050.1 134 AIREE 138
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.40738139IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4039136IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MSRERERYLD EIGKKKEGDG CFKKGRMLGG SGTLNTTTPC AACKLLRRRC AQECPFSPYF  60
SPHEPQKFAS VHKIFGASNV SKMLMEVSEN QRADAANSLV YEANVRLRDP VYGCMGAISS  120
LQQQVQSLLS ELNAIREEIH KYKLIEANML PSSEATVSIA TLPTPSTTTL PMLPSSIYTQ  180
QDNPTNYNTI STDHISYFN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9387101e-104CR938710.1 Medicago truncatula chromosome 5 clone mth2-170k9, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004491050.11e-149PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T52e-70LBD15_ARATH; LOB domain-containing protein 15
TrEMBLG7KH281e-124G7KH28_MEDTR; LOB domain protein
STRINGGLYMA06G15050.13e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.16e-68LOB domain-containing protein 15